MODIFICATION
99 -- Peptide Synthesis - Amendment 1
- Notice Date
- 4/28/2014
- Notice Type
- Modification/Amendment
- NAICS
- 541990
— All Other Professional, Scientific, and Technical Services
- Contracting Office
- Department of Health and Human Services, National Institutes of Health, National Institute of Allergy & Infectious Diseases/AMOB, 10401 Fernwood Drive, Suite 2NE70, MSC 4811, Bethesda, Maryland, 20817
- ZIP Code
- 20817
- Solicitation Number
- RML6-RFQ-14024
- Archive Date
- 5/15/2014
- Point of Contact
- Michael S. Barrett, Phone: 4063759810, Julienne Keiser, Phone: 406-363-9370
- E-Mail Address
-
michael.barrett@nih.gov, jkeiser@niaid.nih.gov
(michael.barrett@nih.gov, jkeiser@niaid.nih.gov)
- Small Business Set-Aside
- N/A
- Description
- Full Peptide Description attached to avoid the system cutting off characters. Please refer to this document when quoting Full Peptide Synthesis. This is in response to a few issues with the full length proteins not being completely viewable. This information will also be attached with a word document. Peptide Synthesis, 20mg at >70%: OVOC8995: 1 EACH MNAGSKHAFVMKIYRCKSQLAFLDTVILSVPTWGSMDEEVHGKEYLGLST PCCVGTCVVECMHGNVPVP Peptide Synthesis, 20mg at >70%: OVOC12838: 1 EACH MLPGFLEYSLAGKALEKKIWNLEVVDIRFFAEDKHSTVDDVPYGGGAGMI MRPDVIGSAVDSVFSAHKNTRFIYMTPSGTKFNQ Both of these full length peptides are not to be conjugated. The three small peptides are the only products needing conjugated. Furthermore, the least purity expected is 70% but the higher the purity the better. This is a onetime shipment and will not be an ongoing service or contain any sort of period of performance. Additionally, the soonest the peptides can be completed and shipped the better. We understand this is a significant undertaking and it may take a few weeks but we would like them by 5/31/2014. Please provide a quote even if you believe the end of May is unobtainable.
- Web Link
-
FBO.gov Permalink
(https://www.fbo.gov/spg/HHS/NIH/AMOB/RML6-RFQ-14024/listing.html)
- Place of Performance
- Address: National Institute of Health, Bethesda, MD 20892, Bethesda, Maryland, 20892, United States
- Zip Code: 20892
- Zip Code: 20892
- Record
- SN03350406-W 20140430/140428234726-f72f0000adcd25b1487043f3daf54c3a (fbodaily.com)
- Source
-
FedBizOpps Link to This Notice
(may not be valid after Archive Date)
| FSG Index | This Issue's Index | Today's FBO Daily Index Page |