SOURCES SOUGHT
A -- Special Order Custom Peptides - Peptide Synthesis SOW/ PWS
- Notice Date
- 8/28/2017
- Notice Type
- Sources Sought
- NAICS
- 541712
— Research and Development in the Physical, Engineering, and Life Sciences (except Biotechnology)
- Contracting Office
- Department of the Navy, Bureau of Medicine and Surgery, Naval Medical Research Center, 503 Robert Grant Ave., Contracting Dept, Bldg 500, Silver Spring, Maryland, 20910, United States
- ZIP Code
- 20910
- Solicitation Number
- N3946717Q0091
- Archive Date
- 9/21/2017
- Point of Contact
- Deborah M. Sharpe, Phone: 301-319-6471, LCDR Nicholas Hamlin, Phone: 210-539-6204
- E-Mail Address
-
deborah.m.sharpe2.civ@mail.mil, nicholas.j.hamlin2.mil@mail.mil
(deborah.m.sharpe2.civ@mail.mil, nicholas.j.hamlin2.mil@mail.mil)
- Small Business Set-Aside
- N/A
- Description
- PWS/ SOW This solicitation is being issued on an unrestricted basis to allow for full and open competition. The associated NAICS code is 334419. Offerors must also be registered in Systems for Award Management (SAM) at www.sam.gov per FAR 52.212.1 lack of registration in SAM will qualify contractor as ineligible for award. All responsible sources may submit a quotation in response to this solicitationwhich shall be considered.The solicitation is being issued as a Request for Quote (RFQ) for a firm fixed type contract based on the lowest Price Technically Acceptable. The Naval Medical Research Center (NMRC) intends to award a contract resulting from this solicitation to the responsible offeror. all offers must have a DUN & Bradstreet Number. A Dun & Bradstreet number may be acquired free of charge by contacting Dun & Bradstreet online at https://www.dnb.com/products/eupdate/requestOptions.html or by phone at (800) 333-0505. This will be for a Base Year with one Option Year Period. Attached SOW / PWS. Peptide #1 Peptide name: PLA2-1(41-50 aa) Sequence (N to C): KKMTGKSGMLWYSAYGCYCGWGGQGRPKDATDRCCFVHDCCYGKVTGCN Quantity: 5mg HPLC purity: >95% N-terminus: Free C-terminus: Free Modifications: None Aliquots: 5*1mg Salt form: TFA salt Estimated Turnaround Time:4-5 weeks Comment: Customer will accept addition of ddt to prevent oxidation Peptide #2 Peptide name: PLA2-2 (51-60 aa) Sequence (N to C): KKMTGKSGMLWYSAYGCYCGWGGQGRPKDATDRCCFVHDCCYGKVTGCNPKMDIYTY Quantity: 5mg HPLC purity: >95% N-terminus: Free C-terminus: Free Modifications: None Aliquots: 5*1mg Salt form: TFA salt Estimated Turnaround Time: 4-6 weeks Comment: Customer will accept addition of ddt to prevent oxidation
- Web Link
-
FBO.gov Permalink
(https://www.fbo.gov/notices/c5087edfe237bab5541160eb9e632e6a)
- Place of Performance
- Address: Naval Medical Research Unit San Antonio, Attn: LCDR Nicholas J. Hamlin, DC, USN, 3400 Rawley E. Chambers, Bldg #3611, JBSA Fort Sam Houston, Texas, 78234, United States
- Zip Code: 78234
- Zip Code: 78234
- Record
- SN04649332-W 20170830/170828231549-c5087edfe237bab5541160eb9e632e6a (fbodaily.com)
- Source
-
FedBizOpps Link to This Notice
(may not be valid after Archive Date)
| FSG Index | This Issue's Index | Today's FBO Daily Index Page |